Protein Info for AMB_RS12780 in Magnetospirillum magneticum AMB-1

Annotation: haloacid dehalogenase type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00702: Hydrolase" amino acids 6 to 189 (184 residues), 83 bits, see alignment E=5.9e-27 TIGR01428: haloacid dehalogenase, type II" amino acids 7 to 200 (194 residues), 184.5 bits, see alignment E=3.4e-58 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 9 to 186 (178 residues), 84.6 bits, see alignment E=1.4e-27 PF12710: HAD" amino acids 10 to 145 (136 residues), 32.3 bits, see alignment E=2e-11 PF13419: HAD_2" amino acids 96 to 195 (100 residues), 50.2 bits, see alignment E=5.4e-17

Best Hits

Swiss-Prot: 48% identical to HAD4_BURCE: (S)-2-haloacid dehalogenase 4A (hdl) from Burkholderia cepacia

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 100% identity to mag:amb2538)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W483 at UniProt or InterPro

Protein Sequence (225 amino acids)

>AMB_RS12780 haloacid dehalogenase type II (Magnetospirillum magneticum AMB-1)
MTLAPVRACVFDAYGTLFDLGSLTRSVRGELGERAETLMRLWRKRQLELSWLPLRPGVRA
DFWRVTDEALEFAMDKMGLDDRGLRLRLMEGWLSPELYPEAAEALARLRRLGFPLAILSN
GSLPMLKSALELPGIRDNIDAVLSAQSVGRFKPDPLVYQLATTHFGMAPESVCFVSGNAW
DVSGAAAYGYQVVWINRDNVPAEKLPLGTRATVANLAELPAILGG