Protein Info for AMB_RS12745 in Magnetospirillum magneticum AMB-1

Annotation: iron-sulfur cluster assembly accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF01521: Fe-S_biosyn" amino acids 12 to 112 (101 residues), 71 bits, see alignment E=4.7e-24 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 12 to 117 (106 residues), 125.7 bits, see alignment E=4e-41

Best Hits

Swiss-Prot: 57% identical to ERPA_POLAQ: Putative iron-sulfur cluster insertion protein ErpA (erpA) from Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)

KEGG orthology group: None (inferred from 100% identity to mag:amb2531)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W490 at UniProt or InterPro

Protein Sequence (117 amino acids)

>AMB_RS12745 iron-sulfur cluster assembly accessory protein (Magnetospirillum magneticum AMB-1)
MAEAEHNYAARVSVTESAAERVQTLIKMEGKPNMMLRLGVSGGGCSGFSYGISLDDTVND
DDRLFSEFGITLVVDQTSLDMLDGSVVDFVEDLSGSSFQVKNPNATSTCGCGSSFSV