Protein Info for AMB_RS12735 in Magnetospirillum magneticum AMB-1

Annotation: deoxyguanosinetriphosphate triphosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR01353: putative dGTPase" amino acids 31 to 391 (361 residues), 345 bits, see alignment E=4.1e-107 PF01966: HD" amino acids 69 to 166 (98 residues), 49.8 bits, see alignment E=4.1e-17 PF13286: HD_assoc" amino acids 300 to 389 (90 residues), 109.5 bits, see alignment E=1e-35

Best Hits

Swiss-Prot: 60% identical to DGTL1_BRUSI: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (BSUIS_A0914) from Brucella suis (strain ATCC 23445 / NCTC 10510)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 67% identity to rru:Rru_A1780)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>AMB_RS12735 deoxyguanosinetriphosphate triphosphohydrolase (Magnetospirillum magneticum AMB-1)
MTESRFHTLAPYACRPEESRGRLHQEADSPTRSPFQRDRDRIIHSAAFRRLQYKTQVFVY
HEGDNFRTRLTHSLEVSQIARSIARVLALDEDLAEALALAHDLGHTPFGHAGEDALQEVL
AEYGGFDHNAQSLRIVTKLERRYVEFEGLNLTWETLEGLVKHNGPLTGPLAVKPDRVLPG
AIAEYAQLHDLRLDSFAGMEAQVAALSDDIAYNNHDIDDGLRAGLFTIKDLADVPLVGPL
FHKVTRQYPDAEPSLHIHEVVRRMIGIMILDLTSETRRRVAEFKPRSADDVRGLGRPLAA
FSDEMRANDSALRQFLFANMYRHFSVNRMTSKGRRVVKDLFRLLFAEPECLPPEWRRLAD
GKGTAKTARVVADYIAGMTDRFALDEHRRLFDLQEKP