Protein Info for AMB_RS12715 in Magnetospirillum magneticum AMB-1

Annotation: site-2 protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 59 to 78 (20 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details PF02163: Peptidase_M50" amino acids 138 to 170 (33 residues), 27.8 bits, see alignment 7.7e-11

Best Hits

KEGG orthology group: None (inferred from 53% identity to rce:RC1_1028)

Predicted SEED Role

"FIG004556: membrane metalloprotease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>AMB_RS12715 site-2 protease family protein (Magnetospirillum magneticum AMB-1)
MMGELGGLLFGITIWAIPLIFAVTLHEAAHGYAAHACGDDTAYRMGRISLNPLRHIDPFG
TIILPGLLLALGGVMFGWAKPVPVNFSRLRHPRRDMVIVAAAGPAMNMGLAILAILAVHL
VPVMPEAIRGWFFLNLENAIFFNLLLAVFNMIPIPPLDGGRVAVGILPRPLAWRLARLEK
AGMLILIAALFLFPLLGSRIGVDLDVFRWLVQGPVDTIGNALVRALGP