Protein Info for AMB_RS12670 in Magnetospirillum magneticum AMB-1

Annotation: protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 8 to 210 (203 residues), 210 bits, see alignment E=1.9e-66 PF01135: PCMT" amino acids 10 to 209 (200 residues), 199.5 bits, see alignment E=1.1e-62 PF00398: RrnaAD" amino acids 71 to 129 (59 residues), 26.3 bits, see alignment E=7.9e-10 PF13649: Methyltransf_25" amino acids 81 to 152 (72 residues), 29.8 bits, see alignment E=1.6e-10 PF08241: Methyltransf_11" amino acids 82 to 153 (72 residues), 23 bits, see alignment E=2e-08

Best Hits

Swiss-Prot: 100% identical to PIMT_MAGSA: Protein-L-isoaspartate O-methyltransferase (pcm) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to mag:amb2519)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4A2 at UniProt or InterPro

Protein Sequence (214 amino acids)

>AMB_RS12670 protein-L-isoaspartate O-methyltransferase (Magnetospirillum magneticum AMB-1)
MKKAEPRVIRLLMELRRMGVVDTRVLSAIERIPRALFVAEPFLDQAYENTALPIGCAQTI
SQPLVVGLMSQALEVGERMKVLEIGTGSGYQAAVLAKLCRRLYSVERHKPLLAEAEARFK
HLRLHNITCRAADGSRGWPEQAPFDRIMVTAAAPDIPPALVDQLKPDGIMVLPLGDVGGI
DQELVRITKTDRGIDIQPFLPVRFVPLVEGIPEE