Protein Info for AMB_RS12650 in Magnetospirillum magneticum AMB-1

Annotation: preprotein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 21 to 102 (82 residues), 97.5 bits, see alignment E=1.8e-32 PF02699: YajC" amino acids 23 to 99 (77 residues), 106.9 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 54% identical to YAJC_BRUA2: Sec translocon accessory complex subunit YajC (yajC) from Brucella abortus (strain 2308)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 100% identity to mag:amb2515)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4A6 at UniProt or InterPro

Protein Sequence (133 amino acids)

>AMB_RS12650 preprotein translocase subunit YajC (Magnetospirillum magneticum AMB-1)
MFVSPAYAQAAAAGGGSFGALEQFLPLILIFVVFYFLLIRPQQKKMKQHKEMLGQLRRGD
RVLTAGGIIGTVNKLINDTEVSVEIAEGVRVRVLRTTITEVMSKTEPVAADKAPATADKA
KDDKSDAEPAADK