Protein Info for AMB_RS12590 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 PF13432: TPR_16" amino acids 8 to 69 (62 residues), 29.9 bits, see alignment E=4e-10 amino acids 77 to 130 (54 residues), 21.1 bits, see alignment 2.4e-07 amino acids 143 to 202 (60 residues), 38.8 bits, see alignment 6.4e-13 PF14559: TPR_19" amino acids 13 to 70 (58 residues), 27.2 bits, see alignment 2.7e-09 amino acids 150 to 203 (54 residues), 25.5 bits, see alignment 9.1e-09 PF07719: TPR_2" amino acids 172 to 203 (32 residues), 28.2 bits, see alignment (E = 8.4e-10) PF13181: TPR_8" amino acids 173 to 203 (31 residues), 23.4 bits, see alignment (E = 2.9e-08) PF13844: Glyco_transf_41" amino acids 287 to 437 (151 residues), 133.4 bits, see alignment E=5.3e-42 amino acids 450 to 634 (185 residues), 136.9 bits, see alignment E=4.7e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2504)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4B7 at UniProt or InterPro

Protein Sequence (658 amino acids)

>AMB_RS12590 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MNIDQDMAKAIKLAQAGKLTPAIAILDGLVRAAPSAVPVRYNLALFLLMAGRHTEALPHL
DRILAAQPGHSPSLFSKAKGLMALDRAAEALPILERLAAGNDPESLLALGNALRTLSRME
EAAQAFHRLTRVAPGFVGGHINLGILLVSMADTQAALSALDDAVRLHPGVGELHALRGQA
LLRLGRHSEAIAALEKALAINPALVPARGHLLRAYRETADWDNEDRLFAEIRAAIQRGEI
KGQLPLSTQDALFYPFTGEEMRRIAELEVAFRVPGQPRPAVHPQPKTAPPLTVGYLSPDF
REHATMHLAGDIFAHHDRSRVRPVAYSVGPDDGSDWRQRMARDCEAFVDLSSLSDRAAAE
RIAADCAHILVDLSVFTRYARPGIAALRPAPVQAVWLGLAASSAAPWLDYAIVDPVLVPP
AHGGHFSEKLIRLPNSYQANLAWSPPGVAPSRASLGLPDDRLVLCSFNGHRKLDRATFTL
WLEILAELPQAVLWLLSPPDLARQRLEAAAAKAGIDSARLIWAPSLPRPDHLARLPAADL
FVDALVCGAHTTAADSLRMGVPLITAAGNRLGSRVAASLLHALGLPDLAVESPSALKALA
IELGRDRSRLAALRTRLMELLPRSPAFDPAGFASHLEDGYEAAWNRHAAGKRPENIDV