Protein Info for AMB_RS12560 in Magnetospirillum magneticum AMB-1

Annotation: penicillin-insensitive murein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03411: Peptidase_M74" amino acids 43 to 276 (234 residues), 310.7 bits, see alignment E=3.7e-97

Best Hits

Swiss-Prot: 42% identical to MEPA_ECOL5: Penicillin-insensitive murein endopeptidase (mepA) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K07261, penicillin-insensitive murein endopeptidase [EC: 3.4.24.-] (inferred from 100% identity to mag:amb2499)

Predicted SEED Role

"Murein endopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4C2 at UniProt or InterPro

Protein Sequence (280 amino acids)

>AMB_RS12560 penicillin-insensitive murein endopeptidase (Magnetospirillum magneticum AMB-1)
MHSLARLMGLAALVLATGAAAAESGQQQWSGIGQPATGPASVIGSPAAGCLKGAVPLAED
EHSFQVLRPSRNRHWGHPATIRFVGDLARATKGEGISGPLLIGDMAQPRGGPMPAGHGSH
QNGLDVDIWFRLPAKPLSRAEIETPKPVSMVYGTEIDEDAWTPAQARLLELAARAPQVDR
IFVNPAIKKAMCRAVPADGDRSWLRKLRPWWGHDEHFHVRLSCPADSPDCERQKPMPEGD
GCGEELESWSARPTWPAPPSRPHHQSRPLPEACAGLFRKG