Protein Info for AMB_RS12525 in Magnetospirillum magneticum AMB-1

Annotation: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase" amino acids 7 to 379 (373 residues), 479.4 bits, see alignment E=3.8e-148 PF02670: DXP_reductoisom" amino acids 7 to 132 (126 residues), 138.1 bits, see alignment E=4.4e-44 PF08436: DXP_redisom_C" amino acids 146 to 229 (84 residues), 134.7 bits, see alignment E=1.5e-43 PF13288: DXPR_C" amino acids 261 to 377 (117 residues), 142.8 bits, see alignment E=8.4e-46

Best Hits

Swiss-Prot: 68% identical to DXR_RHOCS: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 100% identity to mag:amb2492)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4C9 at UniProt or InterPro

Protein Sequence (387 amino acids)

>AMB_RS12525 1-deoxy-D-xylulose-5-phosphate reductoisomerase (Magnetospirillum magneticum AMB-1)
MSGRRGVTILGSTGSIGCNTVDLVERNPDLYRVEALVANSRVDILAEQARKLQAKLAVVA
DESAYGALKSALAGTGIEVAAGAQAVVAAAERPADWVMAAIVGAAGLAPTLAAVRRGAVV
GLANKECLVCAGQLMMAEVEKHGATLLPVDSEHSAIFQVFEADQHDKIDKIILTASGGPF
RTKTREFMADVTPEQAVAHPNWSMGAKISVDSASMFNKGLELIEAHHLFDMPEDKIDIVV
HPQSVIHSLVAYVDGSVLAQLGSPDMRTPIAYALGWPNRMEAPVPKLDLAAIATLTFEAP
DPVRFPSLRLAREALRAGGSAAAVMNAANEVAVAAFLGRRIGFLDIASLVERTVAGVSHC
ELTCIDDVLAQDAEARRFVSALIDGGR