Protein Info for AMB_RS12505 in Magnetospirillum magneticum AMB-1

Annotation: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD
  • amino acids 35 to 338 (304 residues), 357.1 bits, E=3.6e-111
• PF04613: LpxD
  • amino acids 38 to 101 (64 residues), 66 bits, E=6.5e-22
• PF24894: Hexapep_GlmU
  • amino acids 122 to 193 (72 residues), 24.4 bits, E=8e-09
• PF25087: GMPPB_C
  • amino acids 124 to 191 (68 residues), 37.5 bits, E=5.5e-13
• PF00132: Hexapep
  • amino acids 125 to 156 (32 residues), 37.2 bits, 4.6e-13
  • amino acids 140 to 174 (35 residues), 38.8 bits, 1.4e-13
  • amino acids 234 to 269 (36 residues), 34.3 bits, 3.8e-12
• PF14602: Hexapep_2
  • amino acids 141 to 173 (33 residues), 35.5 bits, 1.9e-12

Best Hits

Swiss-Prot: 100% identical to LPXD_MAGSA: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to mag:amb2488)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See Q2W4D3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>AMB_RS12505 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Magnetospirillum magneticum AMB-1)
MADPRFFRVAGPFTLAQLAELSGASVAEGCDLGASFVDVAPLEQAGQDNVSFLDNRKYVG
AFQASKAGLCVIAPEMADKAPEGMALLLSPDPYRAYARIAQAFYPNPAPEPWVAPTAWVD
ASAAVGEGCRIEPGAVIGAGARIGARCRIGANVVIGQGVVLGDDCTIGANATVSHALVGS
RVNIYPGARIGQDGFGFAMGPQGHLKVPQLGRVLIGNNVEIGANTTIDRGAGPDTVIGDG
SMIDNLVQIGHNVQLGRGCVIVAQVGISGSTRMGDFVAAGGQAGITGHLKIGAGAKIAAQ
AGVMRDIAPGETVGGAPAVPMADWLRQSAILGKMARKKS