Protein Info for AMB_RS12495 in Magnetospirillum magneticum AMB-1

Annotation: acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 65% identical to LPXA_METRJ: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 100% identity to mag:amb2486)

MetaCyc: 46% identical to acyl-[acp]--UDP-3-acetamido-2-amino-2,3-dideoxy-alpha-D-glucopyranose N-acyltransferase monomer (Brucella abortus 2308)
RXN2B4Q-48 [EC: 2.3.1.305]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

lipid IV_A biosynthesis (P. gingivalis) (8/9 steps found)
lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
lipid IV_A biosynthesis (E. coli) (5/6 steps found)
lipid IV_A biosynthesis (H. pylori) (5/6 steps found)
lipid IV_A biosynthesis (P. putida) (5/6 steps found)
lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
lipid IV_A biosynthesis (generic) (5/6 steps found)
superpathway of (Kdo)₂-lipid A biosynthesis (10/17 steps found)
superpathway of Kdo₂-lipid A biosynthesis (10/25 steps found)

KEGG Metabolic Maps

Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129 or 2.3.1.305

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4D5 at UniProt or InterPro

Protein Sequence (263 amino acids)

>AMB_RS12495 acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Magnetospirillum magneticum AMB-1)
MTNIHPSAVIDSKAEIASSAIIGPFCVVGPDVKLGESVELVSHVAVAGRTTIGAGTRIFP
FASIGHRPQDLKYKGEPSTLEIGANNQIREHVTMNPGTEGGGMVTRVGDNCLFMASAHVA
HDCILGDNVIMANNATLAGHVTVGEYAFLGGLSAVHQFVRIGRHAMIGGMSGVEADVIPF
GMVIGNRAYLNGLNIVGLKRRGFSRDDIHTLRNAYRLMFAPEGTLAERLSDVEEQFKDHP
VVMEIVAFIRSDSSRSLSTPNGS