Protein Info for AMB_RS12480 in Magnetospirillum magneticum AMB-1

Annotation: lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 TIGR00068: lactoylglutathione lyase" amino acids 3 to 130 (128 residues), 205.2 bits, see alignment E=1.6e-65 PF00903: Glyoxalase" amino acids 5 to 126 (122 residues), 100.9 bits, see alignment E=1e-32 PF13669: Glyoxalase_4" amino acids 8 to 115 (108 residues), 44.6 bits, see alignment E=2.4e-15 PF18029: Glyoxalase_6" amino acids 10 to 126 (117 residues), 25.2 bits, see alignment E=3.3e-09

Best Hits

Swiss-Prot: 69% identical to LGUL_SYNY3: Probable lactoylglutathione lyase (gloA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 100% identity to mag:amb2483)

MetaCyc: 58% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4D8 at UniProt or InterPro

Protein Sequence (130 amino acids)

>AMB_RS12480 lactoylglutathione lyase (Magnetospirillum magneticum AMB-1)
MADWRFLHTMIRVGNLDRSIHFYTSLLGMKLLRRTDYPEGRFTLAFVGYGEEASNTVVEL
THNWDTESYELGGGFGHLALGVPDIYKACAELEAAGAKITRAPGPMKHGSTIIAFVEDPD
GYKIELIQAK