Protein Info for AMB_RS12435 in Magnetospirillum magneticum AMB-1

Annotation: polyphosphate kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR03707: polyphosphate kinase 2" amino acids 77 to 303 (227 residues), 374.2 bits, see alignment E=1.3e-116 PF03976: PPK2" amino acids 79 to 302 (224 residues), 341.2 bits, see alignment E=1.5e-106

Best Hits

Swiss-Prot: 78% identical to PK21B_RUEPO: Polyphosphate:NDP phosphotransferase 2 (ppk2) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: None (inferred from 100% identity to mag:amb2475)

Predicted SEED Role

"Polyphosphate kinase 2 (EC 2.7.4.1)" (EC 2.7.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.1

Use Curated BLAST to search for 2.7.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4E6 at UniProt or InterPro

Protein Sequence (334 amino acids)

>AMB_RS12435 polyphosphate kinase 2 (Magnetospirillum magneticum AMB-1)
MADDGNDFKTETLEITAPPAEPAVAPPVRAARKKAPPAVKPITPAGQARHELAEMRHDPE
AVRHAFETGEYPYKSHMGRAEYEAKKAALQAELLKVQLWARDTGQKFVLLFEGRDAAGKG
GTIKRFMEHLNPRAARVVALEKPSEIERGQWFFQRYIQHLPTSGEMVFFDRSWYNRAGVE
RVMGFCSPAEYLEFMRQTPEVERMLVRSGIKLYKYWFSVTQEEQLRRFKSRERDPLKQWK
LSPIDKASLGKWGEYTDAKEAMFFYTDTADAPWTIVKSDDKKRARLNCMLHFLNSLDYPG
KNESLVHSPDPLIVGKGAHVVHKSERMLGATLSP