Protein Info for AMB_RS12400 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01336: tRNA_anti-codon" amino acids 77 to 135 (59 residues), 27.8 bits, see alignment 5.1e-10 PF00270: DEAD" amino acids 290 to 427 (138 residues), 74.4 bits, see alignment E=2.4e-24 PF04851: ResIII" amino acids 290 to 423 (134 residues), 26.9 bits, see alignment E=1e-09 PF00271: Helicase_C" amino acids 498 to 578 (81 residues), 60.4 bits, see alignment E=4.7e-20 PF19833: RecG_dom3_C" amino acids 607 to 672 (66 residues), 54.8 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to mag:amb2467)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4F4 at UniProt or InterPro

Protein Sequence (693 amino acids)

>AMB_RS12400 ATP-dependent DNA helicase RecG (Magnetospirillum magneticum AMB-1)
MRPQVLFPLFAPVTTLPGIGPRLAPLYQRLVGDKVLDLLWHLPTGVVDRRFAPKVAEAPH
GKVATLTLRVDAHFPSSSPKRPYRVRMSDETGFLHLVFFHGREDWLRKQLPEGEIRVVSG
QVEHFNNEIQISHPDHIVPLDQIAQVMAVEPVYGLTAGLTGRAVAKTVAAAVAKAPELPE
WQDVHWLDRQNWPTWHAALTALHHPADEHGAIGDTPARRRLAFDELLANQLALAMVRAQM
RKLKGRPLVGDGSLRSKVMAALPYTLTGAQSRSLAEIDADMAQPLRMLRLLQGDVGSGKT
VVALLAMLTAVEAGCQAAMMAPTEILARQHYAGIAPLAEAAGLKVALLTGRDKGKARDAV
LAGLASGETHIMLGTHALFQEDVAFKDLALAVIDEQHRFGVHQRLELAAKGLAVDMLVMT
ATPIPRTLLLTAYGDMDASRLDEKPPGRKPIDTRVVPLARLDEMVAGVGRAISGGARAYW
VCPLVEESETSDLAAAEERHRHLSQVFGDRVGLVHGRMKGAAKDKVMAEFAAGELDILVA
TTVIEVGVDVPAANIMVIEHAERFGLAQLHQLRGRVGRGTRESRCLLLYGHPLGEIAKAR
LEIMRATEDGFRIAEEDLRLRGGGEMLGTRQSGLPEFRLADLAIHGELLAAARDDARLIL
DRDPELSGPRGEALRVLLYLFERDAAVRTLRSG