Protein Info for AMB_RS12295 in Magnetospirillum magneticum AMB-1

Annotation: TatD family deoxyribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00010: hydrolase, TatD family" amino acids 2 to 254 (253 residues), 285.8 bits, see alignment E=1.4e-89 PF01026: TatD_DNase" amino acids 3 to 254 (252 residues), 289.2 bits, see alignment E=1.4e-90

Best Hits

Swiss-Prot: 46% identical to Y454_HAEIN: Uncharacterized metal-dependent hydrolase HI_0454 (HI_0454) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 100% identity to mag:amb2447)

Predicted SEED Role

"Putative deoxyribonuclease YcfH" in subsystem YcfH

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4H4 at UniProt or InterPro

Protein Sequence (259 amino acids)

>AMB_RS12295 TatD family deoxyribonuclease (Magnetospirillum magneticum AMB-1)
MLVDSHCHLDFPDFADDLDGVVGRAGAAGVGVLLTIGTHVTRYDQVVKVAERFDNVWATV
GIHPHEAGVEPYADLDTLLRLAEHPKVVAFGETGLDYYYDKSPREQQRHSFRIHIEAARR
TGLPVIVHTRDADDDTAAILAEEMGKGAFTGLIHCFSSRPDFAEKAVKLGLFISASGIMT
FKTADILRDTLAGVPLDRLLVETDAPYLAPIPFRGKRNEPAYVAHTAARLAEVKGVTMAE
METATTDNFHRLFKKVARP