Protein Info for AMB_RS12285 in Magnetospirillum magneticum AMB-1

Annotation: Na+/H+ antiporter NhaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 206 to 234 (29 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 286 to 312 (27 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 12 to 375 (364 residues), 468.1 bits, see alignment E=9.7e-145 TIGR00773: Na+/H+ antiporter NhaA" amino acids 13 to 375 (363 residues), 440.8 bits, see alignment E=2e-136

Best Hits

Swiss-Prot: 100% identical to NHAA_MAGSA: Na(+)/H(+) antiporter NhaA (nhaA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 100% identity to mag:amb2445)

MetaCyc: 54% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4H6 at UniProt or InterPro

Protein Sequence (383 amino acids)

>AMB_RS12285 Na+/H+ antiporter NhaA (Magnetospirillum magneticum AMB-1)
MAAEKPSSIFRDFLDSEAAGGVILMVTAALALVIANSPLSGAYFAFLQAKFLGMSVLHGI
NDGLMAVFFLLVGLEIKREVLGGQLSNWSQRILPGLAALGGMVVPALVFLALNAKSPETV
RGWAVPTATDIAFALGVLALLGPRVPASLKIFLTALAIIDDLGAVLVIALFYTAKLSWPA
LVAVAAILALLAALNRLRVRSLWPYLLVGAGLWGAMLQSGVHATVAGIALALTIPMGDEQ
HSPLHRLEHGLAPWVGYGIVPIFGFANAGVSFAGLEPSRVLQSLPLGIALGLLFGKQIGV
FGTAWMAIWLGFAARPEGAGTAQLYGVAVLCGIGFTMSLFIGALAFGELPASSDAVKVGV
LAGSALSAILGSLVLLRCRSSSS