Protein Info for AMB_RS12080 in Magnetospirillum magneticum AMB-1

Annotation: nucleoside triphosphate pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00444: MazG family protein
  • amino acids 13 to 262 (250 residues), 311.1 bits, E=3.1e-97
• PF03819: MazG
  • amino acids 30 to 103 (74 residues), 103.3 bits, E=6.7e-34
  • amino acids 168 to 234 (67 residues), 50.8 bits, E=1.6e-17

Best Hits

Swiss-Prot: 54% identical to MAZG_ECO57: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Escherichia coli O157:H7

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 100% identity to mag:amb2392)

MetaCyc: 54% identical to nucleoside triphosphate pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• dZTP biosynthesis (3/5 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)
• tunicamycin biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Pyrimidine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8 or 3.6.1.9

Sequence Analysis Tools

See Q2W4M9 at UniProt or InterPro

Protein Sequence (273 amino acids)

>AMB_RS12080 nucleoside triphosphate pyrophosphohydrolase (Magnetospirillum magneticum AMB-1)
MSQDKPIDRLLAIMARLRSPQGGCPWDLEQTFATIAPYTIEEAYEVAEAIEHGDMPQLKD
ELGDLLFQVVFYAQMAKENGDFDFDAIASAISDKMIRRHPHVFVEDDGRDSAGQVEAWEE
TKARERAAKAKGANMGVLDGVARTLPPMTRALKLQNRAARVGFDWDRPETILDKLAEEAQ
EIAEEIRAEAPFDRLEDEMGDVLFVCVNLARKLNIDPERALKRANAKFERRFRHIETELN
ATGRTPQAATLDEMEALWQAAKTLEKAGGHGGG