Protein Info for AMB_RS12070 in Magnetospirillum magneticum AMB-1

Annotation: NADP-dependent 3-hydroxy acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00106: adh_short" amino acids 6 to 185 (180 residues), 176.5 bits, see alignment E=9.3e-56 PF08659: KR" amino acids 6 to 159 (154 residues), 44.8 bits, see alignment E=2.8e-15 PF01370: Epimerase" amino acids 7 to 162 (156 residues), 26.6 bits, see alignment E=8e-10 PF13561: adh_short_C2" amino acids 11 to 223 (213 residues), 116.7 bits, see alignment E=2.6e-37

Best Hits

Swiss-Prot: 66% identical to YDFG_SALTI: NADP-dependent 3-hydroxy acid dehydrogenase YdfG (ydfG) from Salmonella typhi

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mag:amb2390)

MetaCyc: 63% identical to 3-hydroxy acid dehydrogenase YdfG (Escherichia coli K-12 substr. MG1655)
RXN-16000 [EC: 1.1.1.381]; RXN-8974 [EC: 1.1.1.381, 1.1.1.298]; Serine 3-dehydrogenase. [EC: 1.1.1.381, 1.1.1.298, 1.1.1.276]

Predicted SEED Role

"Short chain dehydrogenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.276 or 1.1.1.298 or 1.1.1.381

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4N1 at UniProt or InterPro

Protein Sequence (250 amino acids)

>AMB_RS12070 NADP-dependent 3-hydroxy acid dehydrogenase (Magnetospirillum magneticum AMB-1)
MWKNRTVLVTGATAGFGAATARRFAAAGANMVICGRRTERLEALKAELGGVPCHAATLDV
RDGAAVAAFAAALPWPVDVLVNNAGLALGLEPAQAADLNDWETMIDTNIKGLMYMTRAIL
PGMVERNRGHVVNISSVAGTYPYPGGNMYGATKAAVTQFSLNLIADLVKTKVRVTNIEPG
MCGGSEFSQVRFHGDAEKAAKVYEGTEPLTAEDIAEAVFWSASLPAHVNINRIEMMPVCQ
ASAAFAVHRS