Protein Info for AMB_RS12000 in Magnetospirillum magneticum AMB-1

Annotation: lantibiotic ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 transmembrane" amino acids 31 to 44 (14 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 311 to 311 (1 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 393 to 420 (28 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 179 to 439 (261 residues), 83.3 bits, see alignment E=3.7e-27 PF00005: ABC_tran" amino acids 511 to 659 (149 residues), 81.9 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to mag:amb2377)

Predicted SEED Role

"HlyB/MsbA family ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4P4 at UniProt or InterPro

Protein Sequence (724 amino acids)

>AMB_RS12000 lantibiotic ABC transporter (Magnetospirillum magneticum AMB-1)
MTAAANFTPSHKPNQQAIEQYEQQLAQNALGGFSAASDLAACLLPLLKSLGWKGDPRHVA
ESLPHFANDLDLTGLRNVMATLNFSSRPERLELEVIDPRLLPCLFLPDESHALVVKKIAD
DGEAEVFDSSQGLTVKFDTVGVVGTAYFFTNLGGDAAAAKPASWFKSVLERFRPLYWQAF
FVTFVLNVFSLGTPLFTMSVYDKVIGAESYSMLVSLSIGVTMALAADAVLREVRARILAF
VGARLDNIMGNNIFQHILALPPGFTERATIGAQVARIKDFESVREFFTGPLATVFMELPF
AIFYFTVIALLGGVIALVPVVGTMLFLVGGWAVMPVVRKNVGIASRAGSRRQEFLVEALG
KMRAVKLAAAEHTWVKRYRDMSARAAMGGFKNGMFAVAISTGSNILIISSGLATIMVGVL
GVIDGALSIGGLIAAMMLVWRVLSPLQTGFTMLQRVEQVRGSIRQIDGLMGIKPERDPKA
IVAPLKNIKGRVVFSRVSLRYNNESDPALVGVSFEVEPGEVVCVTGRNGSGKSTILKVLL
GLYTPQAGAVKIDATDIRQIDPIEMRHMISYTPQQCNLFFGTVAQNLRLAHPTATDADIR
WACDQADVWEEIMSLPRGLETRIGEGASEHLPTSFVQKLSLARGYLKRSPIMLFDEPVNG
LDFEGDRTFMQSVENFRGQSTIFMVTHRPSHLRVADRILVFDGGYLRLAGPAEEVRARIP
PDLI