Protein Info for AMB_RS11990 in Magnetospirillum magneticum AMB-1

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01892: acetylornithine deacetylase (ArgE)
  • amino acids 29 to 399 (371 residues), 406 bits, E=7.2e-126
• PF04389: Peptidase_M28
  • amino acids 75 to 168 (94 residues), 24.9 bits, E=2.3e-09
• PF01546: Peptidase_M20
  • amino acids 90 to 401 (312 residues), 117.8 bits, E=9.5e-38
• PF07687: M20_dimer
  • amino acids 193 to 304 (112 residues), 90.3 bits, E=1.2e-29

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 100% identity to mag:amb2375)

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.18

Use Curated BLAST to search for 3.5.1.16 or 3.5.1.18

Sequence Analysis Tools

See Q2W4P6 at UniProt or InterPro

Protein Sequence (404 amino acids)

>AMB_RS11990 acetylornithine deacetylase (Magnetospirillum magneticum AMB-1)
MMATAHKASQSENGSLSQHTKTPLPASIETIAKLIAIDTTSYKTNLQLIDLVDKILSGLG
ASVRRTWDESKNKANIFATIGPSDVPGIVLSGHTDVVPVDGQDWSRDPFHLVQADGKLYG
RGTADMKSFIAICLAMAPQFAAAPLRMPVHFAFSYDEEVGCVGVRRLIDDLAHLPVRPAL
CIVGEPTDMKAVIGHKGKKSVRCHVEGHECHSALNHQGVNAIEIAAEMVTRLRALQRRIR
EQGPFDLGYQPPYTTVHTGTMQGGTALNIVPKSCSFEFEIRNLPDHDPETLMAEVRGWAQ
DLVPEMLAVSEASGITLDEHNSTPGLGMDEMDAAVRLVCALSGANQTSKVAFTTEAGLFQ
QAGIPAVVIGPGSITQAHRPDEFITLEQVAQCEDFLRRLLAHMC