Protein Info for AMB_RS11980 in Magnetospirillum magneticum AMB-1

Annotation: GTPase HflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR03156: GTP-binding protein HflX" amino acids 14 to 372 (359 residues), 452.8 bits, see alignment E=3.5e-140 PF13167: GTP-bdg_N" amino acids 32 to 118 (87 residues), 91.9 bits, see alignment E=6.5e-30 PF16360: GTP-bdg_M" amino acids 121 to 200 (80 residues), 104.6 bits, see alignment E=6.4e-34 PF01926: MMR_HSR1" amino acids 208 to 311 (104 residues), 70.5 bits, see alignment E=2.6e-23 PF19275: HflX_C" amino acids 341 to 424 (84 residues), 47.6 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 100% identity to mag:amb2373)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4P8 at UniProt or InterPro

Protein Sequence (435 amino acids)

>AMB_RS11980 GTPase HflX (Magnetospirillum magneticum AMB-1)
MGEPGSQKTAPSRAMVVHPAFKGGEGNRLPEARLAEAVGLAGAINLDIVAAEAVNVSKVR
PATLIGKGAVERLAELVEERDIALAVVDGHLTPVQQRNLEKAWGCKVIDRTGLILEIFGA
RARTREGTLQVELAALSYQRSRLVRSWTHLERQRGGFGFLGGPGETQIEADRRMIGERIV
KLERELEDVKRTRDLHRKARRRVPYPIVALVGYTNAGKSTLFNQLTRAEVLAKDMLFATL
DPTMRDLVLPSGRKIILSDTVGFISDLPHELVAAFRATLEEVLEADVVVHVRDVSHPDTE
AQAADVDTVLKELGLAEVVDRGLVEALNKIDLLDDERRQEVLNQARRREGVMALSAVTGQ
GVDELLAELDRRLGHARETIDVALSLGDGASIAWLYRHGEVVARRDDEAQAFMRVKLDPA
DVKRFHQRKAEGRGH