Protein Info for AMB_RS11955 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 744 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details PF19312: NtrY_N" amino acids 48 to 307 (260 residues), 122.9 bits, see alignment E=5.4e-39 PF00672: HAMP" amino acids 322 to 369 (48 residues), 51.6 bits, see alignment 2.8e-17 PF00989: PAS" amino acids 390 to 493 (104 residues), 40.2 bits, see alignment E=9.3e-14 PF08448: PAS_4" amino acids 397 to 496 (100 residues), 27.1 bits, see alignment E=1.3e-09 TIGR00229: PAS domain S-box protein" amino acids 398 to 501 (104 residues), 32.8 bits, see alignment E=3.3e-12 PF00512: HisKA" amino acids 507 to 573 (67 residues), 41.8 bits, see alignment E=2.7e-14 PF02518: HATPase_c" amino acids 616 to 726 (111 residues), 85.3 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 52% identical to NTRY_AZOBR: Nitrogen regulation protein NtrY homolog from Azospirillum brasilense

KEGG orthology group: K13598, two-component system, NtrC family, nitrogen regulation sensor histidine kinase NtrY [EC: 2.7.13.3] (inferred from 100% identity to mag:amb2368)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Q3 at UniProt or InterPro

Protein Sequence (744 amino acids)

>AMB_RS11955 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MAFGRRIRHWARRVDLARRLAYGLTFASVPAIVATVWVMGGGGAGPAGPDSRIVLSLLAT
DGILLAALGAVVGFRVLDVLKARRRGASGSKLHLRFIMLFALVAVTPSVLMSVGSTAFFK
YGVESWFSDRVRTALQASLEVAHAYLEEHKRIIGGDALAMANDINREGPLLLRSPQHFAQ
FVGTQAAIRGLTEAIVFDTRGNILARSGLIFAVEASIDQIPAWALDKARSGDVVVLSGAG
EDRVKALVQLQGLFGDTFLYVGRFVDPKVIGHMAKTSEAVAQYENLEGRLSGLEQAFSLI
FAIVALLLVLTAIWVGVSMAVRLATPIGRLIDAAEKVRSGDLDARVAEDAADEIGVLSRA
FNRMTHQLSSQRQDLVDANRELDERRRFTETVLAGVSSGVIGLDAAGRIHLPNRSAGELI
GINLDDNVGQDIRDVIPELSESLDEAIRRPEKLVQREVRLSTAGGRSRILLVRVAAERLE
SEIIGYVVTFDDITELVSAQRTAAWADVARRIAHEIKNPLTPIQLSAERLKRKYLKEIQS
DPETYVNLVETIVRQVGDIGRMVDEFSSFARMPAPQIKPDDLNDICRQAMFLQRTGNPGV
EFVHHLPDGKVPVLCDSRLIGQALTNLLKNAVEAIQGRDDPEAPRGRIALSLVSHSDRLV
VTVEDNGKGLPTENRERLTEPYVTTRTKGTGLGLAIVKKIMEDHGGDLYLEDAPGGGARI
GLVFPSSEQQQSQATGENTVTHGA