Protein Info for AMB_RS11950 in Magnetospirillum magneticum AMB-1

Annotation: nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR01818: nitrogen regulation protein NR(I)" amino acids 9 to 475 (467 residues), 720.7 bits, see alignment E=3.9e-221 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 94.9 bits, see alignment E=1.4e-30 PF00158: Sigma54_activat" amino acids 143 to 309 (167 residues), 242.9 bits, see alignment E=5.8e-76 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 78 bits, see alignment E=3.6e-25 PF07724: AAA_2" amino acids 166 to 287 (122 residues), 28.9 bits, see alignment E=4.4e-10 PF07728: AAA_5" amino acids 167 to 285 (119 residues), 36.9 bits, see alignment E=1.4e-12 PF00004: AAA" amino acids 167 to 303 (137 residues), 24 bits, see alignment E=1.9e-08 PF25601: AAA_lid_14" amino acids 315 to 394 (80 residues), 81.1 bits, see alignment E=1.8e-26 PF02954: HTH_8" amino acids 435 to 474 (40 residues), 51.1 bits, see alignment 3.6e-17

Best Hits

Swiss-Prot: 79% identical to NTRC_AZOBR: DNA-binding transcriptional regulator NtrC (ntrC) from Azospirillum brasilense

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to mag:amb2367)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Q4 at UniProt or InterPro

Protein Sequence (484 amino acids)

>AMB_RS11950 nitrogen regulation protein NR(I) (Magnetospirillum magneticum AMB-1)
MTTTTTATILVADDDRGIRTVLSQALGRAGYEVRTTGNASTLWRWVSEGEGDLVITDVVM
PDESGLDLLPRMKKIRPELRIIVMSAQNTLLTAVKATQRGAFEYLPKPFDLKELVNVVGR
ALSTPRAAPTEAAGGEDEEKLPLIGRSPAMQEIYRTLARLMSTDLSVMITGESGTGKELV
ARALHDYGKRRNGPFVAINMAAIPRELIESELFGHEKGAFTGATQRAAGRFEQAEGGTLF
LDEIGDMPPEAQTRLLRVLQEGEYTTVGGRTPIRANVRIVAATHRDLTQLIRQGLFREDL
FYRLNVVPIRLPPLRERSEDIPELIRHFLAQAGAEGLPSKTIDGQAMDRLRKHRWPGNVR
ELENLVRRLAALYSQEVIGIEVIEQELVGGTPHADAISGGVEGEGLSATVERHLREYFGN
HGDGLPPAGVYDRVLREVERPLVTIALEATRGNQIKAAHLLGVNRNTLRKKIKDLDIQIS
RGLK