Protein Info for AMB_RS11935 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 22 (1 residues), see Phobius details amino acids 35 to 49 (15 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 60 to 264 (205 residues), 48.8 bits, see alignment E=3.6e-17

Best Hits

Swiss-Prot: 57% identical to YNR3_AZOBR: Uncharacterized 28.8 kDa protein in nifR3-like 5'region from Azospirillum brasilense

KEGG orthology group: None (inferred from 100% identity to mag:amb2364)

Predicted SEED Role

"FIG00780073: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Q7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>AMB_RS11935 hypothetical protein (Magnetospirillum magneticum AMB-1)
MSSLALNIVALVALLPAALEALRAGDGRSGRFRLCMALAVTGPALWALSLMGGQWQTSLS
AALWVSIAATAALFAALAQASAQGWRLAPLLMPFLAALGLLASLVQWVEAPSQMSGAVPA
AWLDLHIVVSVLTYALLTLAAVASLATFLQERALKRKAPTQLTRMLPSVADSEGLAGRLL
LASEAVLGLGLATGMATQYFETGTVLALSHKILLSLLAFALIGALLIGHRVCGVRGRVAA
RVVLLSYLLLTLAYPGVKFVTQVLLP