Protein Info for AMB_RS11930 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 5 to 218 (214 residues), 212.9 bits, E=8e-67
• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 6 to 219 (214 residues), 221.3 bits, E=1.1e-69
• PF12804: NTP_transf_3
  • amino acids 7 to 135 (129 residues), 39 bits, E=1.4e-13
• PF02542: YgbB
  • amino acids 227 to 380 (154 residues), 213.2 bits, E=3.7e-67
• TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  • amino acids 230 to 379 (150 residues), 202.5 bits, E=3.9e-64

Best Hits

Swiss-Prot: 100% identical to ISPDF_MAGSA: Bifunctional enzyme IspD/IspF (ispDF) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K12506, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 2.7.7.60 4.6.1.12] (inferred from 100% identity to mag:amb2363)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.7.60, EC 4.6.1.12)

MetaCyc Pathways

• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• isoprene biosynthesis I (8/10 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• superpathway of ergosterol biosynthesis II (12/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60 or 4.6.1.12

Sequence Analysis Tools

See Q2W4Q8 at UniProt or InterPro

Protein Sequence (384 amino acids)

>AMB_RS11930 bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Magnetospirillum magneticum AMB-1)
MAKTVVLVVAAGRGRRFGGDLPKQYHDLAGRMVLRHTLAAFATNPEIGAVRAVIHPDDRQ
LYDMAAAGLNLLEPVHGGATRQDSVRLGLDSLKDLNPDKVLIHDGARPFIDHGTIGRVIR
ALDRHPGALPVVPVADTLKRGQDGFVADTVDRANLFRAQTPQGFRYAEIVAAHHAVIGNE
LTDDAAVAEKAGLAVELVNGAEDNVKITTGADLERARCLFDGPGEVRSASGYDVHRFDPA
KDACWLCGVPVPHEAGLLGHSDADVGLHALTDAVLGAISAGDIGHHFPPTDARWKGAASD
QFLAHAGSLVTAKGGRIVNVDVTIICERPKVGPHRAAMAARVAEILGISQDRVSVKATTT
EGLGFTGRKEGIAAQAMASVWLPR