Protein Info for AMB_RS11910 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 798 PF13432: TPR_16" amino acids 7 to 69 (63 residues), 37.8 bits, see alignment 2e-12 amino acids 76 to 137 (62 residues), 35.1 bits, see alignment 1.5e-11 amino acids 116 to 170 (55 residues), 35.1 bits, see alignment 1.5e-11 amino acids 180 to 240 (61 residues), 35.1 bits, see alignment 1.5e-11 amino acids 244 to 284 (41 residues), 25.8 bits, see alignment 1.2e-08 amino acids 286 to 342 (57 residues), 41.5 bits, see alignment 1.4e-13 PF14559: TPR_19" amino acids 15 to 71 (57 residues), 29.3 bits, see alignment 8.8e-10 amino acids 116 to 169 (54 residues), 25.1 bits, see alignment 1.8e-08 amino acids 223 to 277 (55 residues), 30.5 bits, see alignment 3.8e-10 amino acids 288 to 344 (57 residues), 34.1 bits, see alignment 2.8e-11 PF13181: TPR_8" amino acids 139 to 170 (32 residues), 20.7 bits, see alignment (E = 3.4e-07) amino acids 207 to 238 (32 residues), 21.4 bits, see alignment (E = 2e-07) amino acids 244 to 273 (30 residues), 18.8 bits, see alignment (E = 1.4e-06) amino acids 274 to 307 (34 residues), 23.6 bits, see alignment (E = 3.9e-08) PF07719: TPR_2" amino acids 139 to 169 (31 residues), 25.4 bits, see alignment (E = 1.1e-08) amino acids 172 to 205 (34 residues), 23.4 bits, see alignment (E = 4.4e-08) amino acids 207 to 239 (33 residues), 27.6 bits, see alignment (E = 2e-09) amino acids 310 to 341 (32 residues), 26.4 bits, see alignment (E = 5e-09) PF07721: TPR_4" amino acids 139 to 158 (20 residues), 12.1 bits, see alignment (E = 0.00028) amino acids 207 to 231 (25 residues), 11.2 bits, see alignment (E = 0.00054) amino acids 241 to 263 (23 residues), 14.9 bits, see alignment (E = 3.5e-05) PF13174: TPR_6" amino acids 244 to 272 (29 residues), 14.2 bits, see alignment (E = 6e-05) amino acids 277 to 305 (29 residues), 14.3 bits, see alignment (E = 5.6e-05) PF13176: TPR_7" amino acids 244 to 272 (29 residues), 14.8 bits, see alignment (E = 2.5e-05) amino acids 276 to 306 (31 residues), 15.6 bits, see alignment (E = 1.4e-05) PF13374: TPR_10" amino acids 245 to 269 (25 residues), 15.8 bits, see alignment (E = 1.2e-05) PF00515: TPR_1" amino acids 274 to 307 (34 residues), 29.4 bits, see alignment (E = 5e-10) PF13414: TPR_11" amino acids 283 to 322 (40 residues), 28.9 bits, see alignment 7.6e-10 PF13844: Glyco_transf_41" amino acids 421 to 577 (157 residues), 151.6 bits, see alignment E=2.4e-47 amino acids 584 to 776 (193 residues), 155.2 bits, see alignment E=2.1e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2357)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4R4 at UniProt or InterPro

Protein Sequence (798 amino acids)

>AMB_RS11910 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MDQETFARAQAEHRSGNFAVAEPLYGAILAASPEHVEALYAYGVLLAQTGRLPQSLDHLS
RAARLAPEDGRIGRNFALVLQAAGRLPESEREFGRLRDREPDRAEHRFGLGLVVSAQGRF
DEAISHFQEGLALASQDVEARCNLGLACRAAGRLDEAIDAFAKAAELAPALAKAHGNLGG
ALFAAGRWADAVGAWGRALALEPNHAEVRADMGVALAKLGRQEEAAECFRRAMELDPGNP
AHGYNLGRALQDLGRLEDAAEIYAKVIAVAPDHASAHMNSGVIFKKLGQPDQAVASYDRV
LELDPANGPAWLNRGKALYEAGRVEDALDSFRSALRLMPDDADALCELVNLRKVICDWDG
LEAEEALCRRQVADGKAGIDPQVFMSIPATPAEQRRCGTLWGKMITEDRAHAVHGLDLAP
RAVSPAGSKIRLGYISADFRTHPVAHLMAGVFERHDRSRFEVSAYSIGPYQDSDMRRRLE
AAFDRFVDLEAVGSAEAARRIHGDGIDILVDLTGYTKHCRPEILACRPAPIQVNFLGFTA
TMGVNWMDYILTDAFVAPQARQDGFAEALVHMPHCYLPFGDLAPVGEPVQPRSAYGLPED
AFVYCGFNNPFKFRAEVFDLWADILRAVPQGVLWLREDNDYSRNNLGREIAARGIDPARL
IFAQRTDFAEHMARHRLADLFLDCLPYNAHTTASDALWAGLPVLTRVGETFASRVAGSLL
SGLGLPELITESAEEYRERAIALASRPEELRALKDRLEVNRLTAPQFKSEVFTRDLEAAF
LRMAERSRAGLAPEAFAL