Protein Info for AMB_RS11895 in Magnetospirillum magneticum AMB-1

Annotation: integration host factor subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF18291: HU-HIG" amino acids 3 to 97 (95 residues), 36.8 bits, see alignment E=3.7e-13 TIGR00987: integration host factor, alpha subunit" amino acids 5 to 96 (92 residues), 138.4 bits, see alignment E=4.2e-45 PF00216: Bac_DNA_binding" amino acids 7 to 95 (89 residues), 97.1 bits, see alignment E=5.7e-32

Best Hits

Swiss-Prot: 100% identical to IHFA_MAGSA: Integration host factor subunit alpha (ihfA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 100% identity to mag:amb2355)

Predicted SEED Role

"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4R6 at UniProt or InterPro

Protein Sequence (106 amino acids)

>AMB_RS11895 integration host factor subunit alpha (Magnetospirillum magneticum AMB-1)
MTDKTITRAQLSEAVYQEVGLSRNESADLLEAVLDEISGALAKGDAVKISSFGSFSVRSK
GQRIGRNPKTGEEVPITPRRVLVFRPSQLLKKKINDGMAAKRGGAK