Protein Info for AMB_RS11860 in Magnetospirillum magneticum AMB-1

Annotation: sodium-translocating pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 52 to 69 (18 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 289 to 317 (29 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 469 to 486 (18 residues), see Phobius details amino acids 507 to 527 (21 residues), see Phobius details amino acids 575 to 596 (22 residues), see Phobius details amino acids 603 to 624 (22 residues), see Phobius details amino acids 672 to 691 (20 residues), see Phobius details TIGR01104: V-type H(+)-translocating pyrophosphatase" amino acids 3 to 691 (689 residues), 931.1 bits, see alignment E=2.6e-284 PF03030: H_PPase" amino acids 11 to 686 (676 residues), 896.3 bits, see alignment E=7.4e-274

Best Hits

Swiss-Prot: 68% identical to HPPA_RHILO: K(+)-insensitive pyrophosphate-energized proton pump (hppA) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 100% identity to mag:amb2348)

Predicted SEED Role

"Pyrophosphate-energized proton pump (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.1

Use Curated BLAST to search for 3.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4S3 at UniProt or InterPro

Protein Sequence (693 amino acids)

>AMB_RS11860 sodium-translocating pyrophosphatase (Magnetospirillum magneticum AMB-1)
MTYLFVIACGVLALLYGVYAIKSVMATSAGTARMQEIAAAVQEGAAAYLNRQYTTIAMVG
VVVAIILAARLGIYQAVGFVIGAVLSGVAGYVGMNVSVRANVRTAEAARSGGMQQALDVA
FKSGAITGLLVVGLGLIGVAGYYMILKNVGIDPRGLLEALVALSFGASLISIFARLGGGI
FTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDCAGMAADLFETYAVTVVGTM
LLGSIFFTGVAQEQMMMLPLIICGVCIFASIVGTFFVKLDATNNIMKALYKGVIVTAVLS
AIFVAVIINVYLGGFAATFKTATLTITGMDLYVCAIIGLVVTGLLVWITEYYTGTDYRPV
KSVAQASTTGHGTNVIQGLAVSMEACALPVIVISVAIIVSYKIAGLFGISVAATTMLALA
GMIVALDAYGPVTDNAGGIAEMAELPKEVRKTTDALDAVGNTTKAVTKGYAIGSAGLASL
VLFAAYTEDLHHYFPNLNITFSLEDPFVVVGLFLGGLLPYLFGAMGMQAVGRAAGSVVVE
VRRQFKEIPGIMEGTSKPDYGRAVDMLTKAAIKEMIVPSMLPVLSPIVLYFVILLAADQK
AAFTAVGAMLLGTIVTGLFVAISMTSGGGAWDNAKKYIEDGHHGGKGSDAHKAAVTGDTV
GDPYKDTAGPAVNPMIKIINIVAILLLAMVAGH