Protein Info for AMB_RS11825 in Magnetospirillum magneticum AMB-1

Annotation: bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF00383: dCMP_cyt_deam_1" amino acids 1 to 93 (93 residues), 58.2 bits, see alignment E=9.8e-20 TIGR00326: riboflavin biosynthesis protein RibD" amino acids 1 to 353 (353 residues), 355 bits, see alignment E=4.5e-110 PF14437: MafB19-deam" amino acids 20 to 111 (92 residues), 35.5 bits, see alignment E=1.3e-12 TIGR00227: riboflavin-specific deaminase C-terminal domain" amino acids 140 to 353 (214 residues), 188.7 bits, see alignment E=1e-59 PF01872: RibD_C" amino acids 141 to 351 (211 residues), 168.3 bits, see alignment E=2.8e-53

Best Hits

Swiss-Prot: 46% identical to RIBD_ACTPL: Riboflavin biosynthesis protein RibD (ribD) from Actinobacillus pleuropneumoniae

KEGG orthology group: K11752, diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC: 1.1.1.193 3.5.4.26] (inferred from 100% identity to mag:amb2341)

Predicted SEED Role

"Diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) / 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)" in subsystem Riboflavin, FMN and FAD metabolism (EC 1.1.1.193, EC 3.5.4.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.193 or 3.5.4.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4T0 at UniProt or InterPro

Protein Sequence (358 amino acids)

>AMB_RS11825 bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD (Magnetospirillum magneticum AMB-1)
MRAALALARRGLGTVWPNPAVGCVIVKDGRVVGRGWTQPGGRPHAETEALAMAGSAALGA
TVYVTLEPCAHHGKTAPCADALVAAGVSRVVVAVQDPDSRVAGKGVDRLRVAGIPVTEGV
LHAEAAELNAGFFLRINTGRPLVTLKLATTLDGRIATHTGESRWITGDQARSAAHLLRAE
TDAIMVGSGTALHDDPDLTCRLPGLVERSPVRVVVDGRLRLPLTSRLVATANDVPTWLLT
LEDCDVNRREAYEDAGVDVVEVSPGADGAIDLELALQALGESGVTRVLVEGGAHLSAALL
RAGLVDRMVWFRAPRLMGGDGLPAAVSFGIDHLAQTPHFERVEIRPVGDDVMETYIRL