Protein Info for AMB_RS11805 in Magnetospirillum magneticum AMB-1

Annotation: MucR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF05443: ROS_MUCR" amino acids 13 to 135 (123 residues), 170.5 bits, see alignment E=7.2e-55

Best Hits

Swiss-Prot: 49% identical to ROSR_RHIEC: Transcriptional regulatory protein RosR (rosR) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: None (inferred from 100% identity to mag:amb2337)

Predicted SEED Role

"Transcriptional Regulator, MucR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4T4 at UniProt or InterPro

Protein Sequence (151 amino acids)

>AMB_RS11805 MucR family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MSDINSDKTNRDDLLRMAVDVVAAYVGKNPVPAGQLPELINTVYGSLSSLEGGQPEAKSE
APKPAIAVKRSVTPDYIICLEDGKKLKMLKRHLRTTYNMTPDEYRMKWGLPPDYPMVAPN
YAAQRSDFAKKIGLGRKAGETPERPTRRGRR