Protein Info for AMB_RS11790 in Magnetospirillum magneticum AMB-1

Annotation: NnrS family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 369 to 392 (24 residues), see Phobius details PF05940: NnrS" amino acids 19 to 397 (379 residues), 360.4 bits, see alignment E=7.1e-112

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to mag:amb2334)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4T7 at UniProt or InterPro

Protein Sequence (403 amino acids)

>AMB_RS11790 NnrS family protein (Magnetospirillum magneticum AMB-1)
MATIPLMEPVYKGSQGPVFFAAGFRPFFLFAAIQAAVMLPLWLLAFAGHLPVAANWNPVV
WHSHAMVFGLGGAAVGGFLLTAVPNWTNSHHVSGKPLMALFALWLGGRAAVAMAGILPPA
LVAVVDLGYLPLLAFLLAKPLIQAGKWRNIVFLPILGVLWLAGMCAHIEALTGKAVGLKG
VTLGIFVLLLMIAIVGGRIIPSFTQNWLRMQGRPVEVAPVGWIESGGAGAIVALAGLAQV
LAPSSPVAGALLLLAAVVHAWRLSGWHGLKTLSSPILVVLHVGYAWMVLGFALLGLSAFI
EALPPSAALHALTAGSIATMIIAVMSRAALGHAGHPLVVAKATVWAYGLISAGALLRVVA
PVIPDGMMALTMAGGSLWTLGWILYVVVYFPICTKPRADGRPG