Protein Info for AMB_RS11750 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details amino acids 280 to 306 (27 residues), see Phobius details PF02653: BPD_transp_2" amino acids 34 to 292 (259 residues), 130.2 bits, see alignment E=4e-42

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb2325)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4U6 at UniProt or InterPro

Protein Sequence (316 amino acids)

>AMB_RS11750 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MTLPSSVSSRQKPFVLALLGLGLVLPLAVYPVFLMKGLCFGLFAAAFNLLLGYVGLLSFG
HAMFFGWSAYVTAYAAKEWGLTPELAILLGVALATALGAVVGWLAIRRQGIYFAMITLAL
AQLGFFVAVQAPMTHGEDGIQGVPRGMLFGLIDLSNTMAMYYFVLAVFVLSLLFLHRVVN
SPFGQVLKAIRDNEPRAISLGYEVTRYKLIAFVLSSAFAGLAGSLKSLVFQLASLADVSW
HMSGEVVLMTLLGGVGTVLGPMVGAFLVVAIQDFFAGIGSWVIIIQGIIFVVCVLLFRSG
MIGVLAPWLKRRGITG