Protein Info for AMB_RS11735 in Magnetospirillum magneticum AMB-1

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00510: lipoyl synthase
  • amino acids 11 to 302 (292 residues), 380.9 bits, E=2.2e-118
• PF16881: LIAS_N
  • amino acids 11 to 58 (48 residues), 31.4 bits, 2.2e-11
• PF04055: Radical_SAM
  • amino acids 73 to 236 (164 residues), 71.3 bits, E=1.2e-23

Best Hits

Swiss-Prot: 76% identical to LIPA_RHORT: Lipoyl synthase (lipA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to mag:amb2322)

MetaCyc: 50% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

See Q2W4U9 at UniProt or InterPro

Protein Sequence (312 amino acids)

>AMB_RS11735 lipoyl synthase (Magnetospirillum magneticum AMB-1)
MSDKQPLRHPEKARKPDQISPRKPDWIRVKAPTSEEAAEVRRLMREKNLHTVCEEAACPN
IGECWKHKHATFMILGDTCTRACAFCNVKTGNPKGSVDLTEPEHLAESVKAMGLKHVVIT
SVDRDDLADGGAFQFVACIERIRAVTPQCTIEVLTPDFRDKGDGVERIAVARPDVFNHNL
ETVPRLYPGIRPGARYFESLRVLQRAKAADPSIFTKSGIMVGLGEERAEVLQVMDDMRSA
GVDFITIGQYLQPTLKHVAVSSFVTPDEFVDYAAQARAKGFLMVAATPLTRSSHHADRDF
EALKAERLRRQG