Protein Info for AMB_RS11730 in Magnetospirillum magneticum AMB-1

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF07992: Pyr_redox_2" amino acids 6 to 322 (317 residues), 226.7 bits, see alignment E=1.8e-70 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 6 to 462 (457 residues), 561.4 bits, see alignment E=7.2e-173 PF00890: FAD_binding_2" amino acids 7 to 46 (40 residues), 28.6 bits, see alignment 3.4e-10 PF12831: FAD_oxidored" amino acids 7 to 42 (36 residues), 36.1 bits, see alignment 2e-12 PF01134: GIDA" amino acids 7 to 145 (139 residues), 36.6 bits, see alignment E=1.2e-12 PF13738: Pyr_redox_3" amino acids 9 to 306 (298 residues), 53.1 bits, see alignment E=1.3e-17 PF00070: Pyr_redox" amino acids 172 to 249 (78 residues), 75.8 bits, see alignment E=1.3e-24 PF02852: Pyr_redox_dim" amino acids 343 to 451 (109 residues), 128 bits, see alignment E=7.7e-41

Best Hits

Swiss-Prot: 60% identical to DLDH_ZYMMO: Dihydrolipoyl dehydrogenase (lpd) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to mag:amb2321)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4V0 at UniProt or InterPro

Protein Sequence (462 amino acids)

>AMB_RS11730 dihydrolipoyl dehydrogenase (Magnetospirillum magneticum AMB-1)
MAENSFDIIVIGGGPGGYVAAIRAAQLGMNTALVEREHLGGICLNWGCIPTKALLRSAEI
YRNMQHAESYGLSAPGATFDLAKIVARSRGVSAQLQGGVKHLLKKNKVTVIEGTAKLAGG
SKVAIEGKPTISAPHIILATGARARILPGFEPDGKFIWTYKEALVPDTMPKRLLVIGSGA
IGIEFASFFNALGAQVTVAEAMDRVLPVEDAEISAMAQKSFEKQGMKILAGANIKGLKKN
AVDVTVTIEAGGKTHEVTVDRIITAIGIVGNVENVGLEATKAKVERTHVITDEYCRTGEP
GLYAIGDIAGAPWLAHKASHEAIICVEKIKGLPDVHPLDMRKIPGCTYCHPQVASVGLSE
AKAKEKGYAVKVGRFPFMANGKAIALGETEGMIKTVFDAKTGELLGAHMIGAEVTELIQG
YVVAKTLETTEAELMHTVFAHPTLSEMMHESVLDAYGRAVHF