Protein Info for AMB_RS11695 in Magnetospirillum magneticum AMB-1

Annotation: MgtC/SapB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 115 to 145 (31 residues), see Phobius details PF02308: MgtC" amino acids 24 to 154 (131 residues), 120.3 bits, see alignment E=3.1e-39

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to mag:amb2314)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4V7 at UniProt or InterPro

Protein Sequence (241 amino acids)

>AMB_RS11695 MgtC/SapB family protein (Magnetospirillum magneticum AMB-1)
METLLAYWSSKELITNGLILLHMLGALVTGLMIGYERSYHGRAAGLRTYSLVCMASTALT
VVNGYPHMWYAGLSDTPGIADPTRTIQGIMTGIGFLGAGVIMKEGFSIRGLSTAASIWVT
AAIGVLIGVGFYGAAIFGALCTMVVMTAARRIEHALPHQTALHLTLTYLHKQTPPAEEIH
AMLARHGFVARDWSFQLEDGGRLFQYQVSLAAEREPAPLELLDTLSRTESLAGFSLTPAR
S