Protein Info for AMB_RS11680 in Magnetospirillum magneticum AMB-1

Annotation: zinc transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 41 to 72 (32 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 115 to 141 (27 residues), see Phobius details amino acids 171 to 201 (31 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details PF00950: ABC-3" amino acids 1 to 255 (255 residues), 240.8 bits, see alignment E=1.9e-75 PF01032: FecCD" amino acids 43 to 227 (185 residues), 31.6 bits, see alignment E=9.3e-12

Best Hits

Swiss-Prot: 44% identical to ZNUB_HAEIN: High-affinity zinc uptake system membrane protein ZnuB (znuB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 100% identity to mag:amb2311)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4W0 at UniProt or InterPro

Protein Sequence (260 amino acids)

>AMB_RS11680 zinc transporter (Magnetospirillum magneticum AMB-1)
MDDFLLRALMAGAAVALVAGPLGCFIVWRRMAYFGDALAHSALLGIVAGLLLGVAPLVGV
VALCVIAAVILSRAEADRSAGGDSLLGILAHGSLALGLVLLSLMDRVRVDLMGWLFGDIL
AVTASDMAWLWGGGAVVLAVLGWQWRSLIAAAVDEDLAVVEGHKVARSRMLLMLLVALGV
AAAMKVVGVMLVTAMLIIPAAAARRLSRTPERMAVLAALAGLIAVALGLGGSWVWDIPSG
PSIVTVATALFLLSRTISRR