Protein Info for AMB_RS11675 in Magnetospirillum magneticum AMB-1

Annotation: Mn2+/Zn2+ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to ZNUC_MAGSA: Zinc import ATP-binding protein ZnuC (znuC) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to mag:amb2310)

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4W1 at UniProt or InterPro

Protein Sequence (262 amino acids)

>AMB_RS11675 Mn2+/Zn2+ABC transporter ATP-binding protein (Magnetospirillum magneticum AMB-1)
MSLLNLSGVRLSHGGHLVLDRVDLTVDAGRIITVVGPNGAGKSSLLKVALGLLRPDAGTV
ERGAKVIGYVPQRLDIGRLLPLSVRRFLAMAVAERPPAGRLEETLDLVGAGHVLGRQVVD
LSGGEMQRVLLARALLRRPDLLVLDEPVGGVDVAGQAELYDLITGQAREHGVGVLMVSHD
LHVVMAATDHVVCLNRHVCCAGHPETVSRHPEYLALFGPRVAASLAIYTHAHDHGHGADG
SVLPLAEGGGEPHTHGPGCRHG