Protein Info for AMB_RS11585 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details PF02743: dCache_1" amino acids 67 to 299 (233 residues), 55.7 bits, see alignment E=1.5e-18 PF08448: PAS_4" amino acids 373 to 469 (97 residues), 34.2 bits, see alignment E=8.1e-12 PF13426: PAS_9" amino acids 373 to 467 (95 residues), 62.3 bits, see alignment E=1.4e-20 TIGR00229: PAS domain S-box protein" amino acids 376 to 474 (99 residues), 59.4 bits, see alignment E=1.9e-20 PF08447: PAS_3" amino acids 377 to 461 (85 residues), 37.2 bits, see alignment E=8.7e-13 PF00989: PAS" amino acids 377 to 465 (89 residues), 31.3 bits, see alignment E=5.2e-11 PF02518: HATPase_c" amino acids 602 to 708 (107 residues), 75.5 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2291)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Y0 at UniProt or InterPro

Protein Sequence (713 amino acids)

>AMB_RS11585 PAS domain-containing protein (Magnetospirillum magneticum AMB-1)
MQAANPITPEESRPANASVDLGSVPVNPVFSRRLISAVVVFGVGMALAVAVSTTLGLLAG
RQEAISGAEAVARNLSRSLTESVERSINSIDVTLASVAELALEQGMKAKGFDLRAPVAQR
LTFIPYLRQILVVRADGAVLFDSADQSDGRSLDLGGLLAEHERLPRPLVIGLPVDGRFIG
AGTRGGGHRTIPVSRAIRGAEGRILGLVIGAVNPDYFVASFQGIEAESGAHTHLWRFDGL
LLAGAGGSDDFHQDRGSDNPLFTRYLKEAEMGTFLGTWGDGETWITSYRTTLSWPLVVSV
SISQNTALEGWTRSVETIAWPVAAVTLIVLGLTAAMAGMLRKRGRDEARLRLSDMVLSNV
SNGVTIAEVGRGDLPLIYANPAFEHITGYLAKNVLGRNARFLHEFDPGQPGLDDIRAALA
EGVPVSVVLRNQRADGTLFWNQLSLSPMRGTDGKLTHWVGVQRDITEQEEARASLAKAYD
DVAHYSEDLERFSFVLAHHLQEPARQMRLQAQVLLQRIEDMPDTGAEQPAHLIIEAAKRL
VDILRDVQAYLAIERQPVAGGTASSESALAAALNRFIDSERIGPVTVERGLLPRAGVPQK
YLDDLFEILIENAVRFRHAERPLHLRIGAESHPDGWLFKVEDNGIGIDPGYHERVFVALE
RLHTGTTYGGTGIGLAIARKITETLGGRIWVQSDGTSGTAILFTLPMTPGGVV