Protein Info for AMB_RS11540 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR00229: PAS domain S-box protein" amino acids 64 to 180 (117 residues), 26.5 bits, see alignment E=2.9e-10 PF00989: PAS" amino acids 67 to 173 (107 residues), 25.3 bits, see alignment E=3.3e-09 PF08448: PAS_4" amino acids 70 to 178 (109 residues), 28.8 bits, see alignment E=3.1e-10 PF00512: HisKA" amino acids 199 to 243 (45 residues), 27.1 bits, see alignment 8.9e-10 PF02518: HATPase_c" amino acids 334 to 441 (108 residues), 88.9 bits, see alignment E=8e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2282)

Predicted SEED Role

"Signal transduction histidine kinase HoxJ (hydrogenase regulation)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Y9 at UniProt or InterPro

Protein Sequence (442 amino acids)

>AMB_RS11540 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MAQLTDPRPSSAYDFAGGYDPDMAAAQETAWIEVIRKMEEVYSDLISYEVELEEKNTALE
EAQRFINSVLSAVSDILIVCDQNGRIQQVNLAFLQLTGLAEVDLFECPLEDLLAEDTGQL
RLFSWIDAVEGHDREVRFRSADGGLTDPVALSCATRLDHRGLPAGIVLTGRPVGELRRAY
EALKTAQAQLIQQEKMASLGRLIAGVAHELNNPISFVYGNVHALSKYSTRIAAYLDAIHA
GCDETEREALRASLRIDSTLADLPALMEGTAEGAQRVADIVRSLKRLSFSAGSKPEEFDL
GEVVAKAVQWSGSGKKGLASIELDLPDHLAVRGNPGQLHQVIVNLIENALDAVAGRPDGR
VEVTGKAEGGQTVLTIADNGPGIPPDIVGKVFDPFFTTKPVGKGTGLGLWISYGIIRDHG
GSLEAGATASGGARFTISLPPA