Protein Info for AMB_RS11530 in Magnetospirillum magneticum AMB-1

Annotation: 3-phenylpropionate MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details PF12832: MFS_1_like" amino acids 9 to 351 (343 residues), 221.7 bits, see alignment E=3.3e-69 PF01306: LacY_symp" amino acids 10 to 167 (158 residues), 35.6 bits, see alignment E=9.8e-13 PF07690: MFS_1" amino acids 14 to 337 (324 residues), 61 bits, see alignment E=2e-20 PF03825: Nuc_H_symport" amino acids 29 to 371 (343 residues), 49.3 bits, see alignment E=7.8e-17

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 100% identity to mag:amb2280)

Predicted SEED Role

"Probable 3-phenylpropionic acid transporter" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Z1 at UniProt or InterPro

Protein Sequence (386 amino acids)

>AMB_RS11530 3-phenylpropionate MFS transporter (Magnetospirillum magneticum AMB-1)
MSPTSASARLGTYYAALFVAVGIHIPFWPLWLQSRGMSASEIGLVAAAGYLTRILASPVI
GHLADHGGQRRLLMIRLALAAGLIWLLFPLANGFWPILVLSVVAIFPFTGLVPLGDTLAM
MVVSRHGLDYGRARLWGSLSFIAAATLLGKALESWPVAVLPWLMTGALLLTAASCLGLPD
IKVPRHEGKPPSLRPVLLNPLFLLFLGTTALNQMAHTVYYAFATIHWKAAGLSDMVIGVL
WSEGVVAEIILFAVSNRVVGRFGPAALLLAAALGGVVRWLLLGSTASLPLVALAQLLHAA
TFGCAHLGAIHFIARAVPAGLSARTQGIFAAMAIGLAPGLITPFSGRLYENLGGGSYLAM
AGLSVMSAGLAWALMRRWTSGARITE