Protein Info for AMB_RS11520 in Magnetospirillum magneticum AMB-1

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 361 to 388 (28 residues), see Phobius details amino acids 403 to 426 (24 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF02417: Chromate_transp" amino acids 16 to 178 (163 residues), 148.1 bits, see alignment E=1.3e-47 amino acids 249 to 444 (196 residues), 113.7 bits, see alignment E=4.6e-37 TIGR00937: chromate efflux transporter" amino acids 20 to 387 (368 residues), 213.8 bits, see alignment E=3e-67

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to mag:amb2278)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Z3 at UniProt or InterPro

Protein Sequence (452 amino acids)

>AMB_RS11520 chromate transporter (Magnetospirillum magneticum AMB-1)
MSQLPSDAHPTFGEAIRVWLRIGLLSFGGPAAQIATMHRILVDERKWVGEARFLHALNFC
MLLPGPEAQQLATYIGWLLHRTRGGLVAGILFVLPGFLVMMGLAALYAGFHQVPLVDGLF
YGIKPAVLAVVIEATLRIGRRALRGVEKLGIAILAFLGIFAFDLPFPLIVLAAGAWGFMA
ARAGRAAFLPAGGGQAGAMGAADRAIDEGAGHTRPDHWRSVRMAVFCLVLWLAPVVAAMV
WGQGAYGAIGLFFSKMAVVTFGGAYAVLAYVAQQAVEVHGWLAPSEMLDGLGLAETTPGP
LILVNQFVGFLAGFRDHGGLGPWTGGVLGAALTVWVTFTPCFLWILAGAPYVEVLRGYKA
LSGALAAITAAVVGVIFNLGLWFALHVLFGTVDEMRVGAVRLFVPQLASLDPAALALAVA
AAIAMLRLHIGMIPTLAAAGLSGIVWKLFLFP