Protein Info for AMB_RS11515 in Magnetospirillum magneticum AMB-1

Annotation: DUF3365 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 764 to 780 (17 residues), see Phobius details PF11845: DUF3365" amino acids 105 to 221 (117 residues), 58.2 bits, see alignment E=5.1e-19 TIGR00229: PAS domain S-box protein" amino acids 271 to 393 (123 residues), 70.1 bits, see alignment E=1.9e-23 PF00989: PAS" amino acids 278 to 384 (107 residues), 48.6 bits, see alignment E=3e-16 PF13426: PAS_9" amino acids 284 to 386 (103 residues), 58.5 bits, see alignment E=2.7e-19 PF08447: PAS_3" amino acids 296 to 379 (84 residues), 36.7 bits, see alignment E=1.6e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 397 to 556 (160 residues), 134.2 bits, see alignment E=3.6e-43 PF00990: GGDEF" amino acids 398 to 554 (157 residues), 165.5 bits, see alignment E=3.6e-52 PF00563: EAL" amino acids 576 to 809 (234 residues), 260.3 bits, see alignment E=6.3e-81

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2277)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Z4 at UniProt or InterPro

Protein Sequence (831 amino acids)

>AMB_RS11515 DUF3365 domain-containing protein (Magnetospirillum magneticum AMB-1)
MQSPPAGMDSEIGVVTLSSRRKRHILDLVIRYCAAAVMVWTALLGLSLFWNVRQQQAAVF
DLARNTAISAFNKDLAYRRWASSHGGVYVEPSEKTPPSPWMSHLPDRDVVTNDGRLLTLM
NPAYMLREMMADYGDDYGIKGRIVGIVTLNPNNEADAWEAEAIRQFSAGTMSEKLELSTI
GDKPYLRLIKPFLMEESCQKCHGHLGFPNGSVRGAVGVSVPMQPYQAMEGQAIRIQAISH
GAFWLVGVAGILLIGRRSAGRLTEKALADEETRLAAHVFSNALEATLITDPKGRILRINP
MFTELTGYGEAEVVGGNPRIIRSNHHDADFYAEIWQAIFRDGRWQGEIWNRRKDGQVFVA
WESIVAVYDEAGAIRYFIGSFRDITEQVEAQRHILRLAHYDVLTDLPNRVLFQDRLERAV
VHALRHDRQAALLFLDLDGFKKVNDTMGHRAGDDLLKEVAVRLRGCVRMTDTIARLGGDE
FTVILDEISAANDASMVADKILASLHAPIFIDGRDVFIGTSIGISLFPIDGTSGDELLKH
ADTAMYQAKAAGKGRFNFYSAEMTKREEHRLELETALRQAVEEGQFQVHYQPQKNLATNR
VSGFEALVRWQHPRLGMISPVDFIPLAEEMHLIDRIDMFVMRQACRKGRQWRDQGYDICM
AVNLSGVNFSRDDLPEQVRQVLEDTGFPAENLELEITESFVIDLEVDQREVLQRLRALGV
KLAIDDFGTGYSSLSYLKRLPVNTLKIDRSFVRDIARDSRDMMLVSSIIGIAHSLGLKVV
AEGIEERDQLAILLSQECDEIQGYLIAKPMPAEQAGIFLNGASADHVSTPI