Protein Info for AMB_RS11460 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 107 to 108 (2 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 249 to 266 (18 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 197 (171 residues), 48.6 bits, see alignment E=5.7e-17 amino acids 215 to 396 (182 residues), 37.8 bits, see alignment E=1.2e-13 PF06779: MFS_4" amino acids 27 to 384 (358 residues), 245.8 bits, see alignment E=9.4e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2264)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W507 at UniProt or InterPro

Protein Sequence (399 amino acids)

>AMB_RS11460 MFS transporter (Magnetospirillum magneticum AMB-1)
MESPTKEPLMRRPGPLRATFSALCANLVGIGLARFAYSPLIPALVNEGWFEASAAAYLGA
ANLAGYLAGALSARFLAHRFGAATALRAMPALIAVSFLVCAQPQPFIWFFVWRFLSGMAG
GVIMVLAATLALPHVPESRRGLAGGLIFMGVGLGAVISAALLPPLLARGLPFTWITLGVI
CTGFTLAAWNGWPDDKVPASAGAAPVPRDPRLRALMLVYGLNAFGLVPHMVFLADYVARG
LSQGIERGALVWLLFGLGASIGPVVLGRLGDRFGFGVTLRGALVAQAVVVALTSTTSEVG
WLALAGFIMGGFCPGVVPVALGRVRELLPGDHAGQRAAWSRTTAAFALGQAGGAYGLAWL
FSQGGGYGPLFLAGAAALVLGLVVELAVRPRRSEASEPA