Protein Info for AMB_RS11450 in Magnetospirillum magneticum AMB-1

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF01810: LysE" amino acids 17 to 206 (190 residues), 112.1 bits, see alignment E=1.3e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2263)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W508 at UniProt or InterPro

Protein Sequence (208 amino acids)

>AMB_RS11450 LysE family translocator (Magnetospirillum magneticum AMB-1)
MIDSVQALGFLAAAMLITLSPGPDNLMILSLGLSRGRRSGMAFGLGCALGCLSHTLLAAL
GISAAIAASPLLFTGLKLTGGAYLVWLGIGALRSRGAMRIDGTVGGSESLAVLFRRGLLA
NAINPKVVLFFLAFLPQFVVADKGDAGWQIAQLGLLFTLQACVLFGIIGWFAGSLGGWLG
RHGRAGLWLDRLAGGVFIALGLKLIVAR