Protein Info for AMB_RS11430 in Magnetospirillum magneticum AMB-1

Annotation: GTPase Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00231: small GTP-binding protein domain" amino acids 11 to 167 (157 residues), 81 bits, see alignment E=8.5e-27 TIGR00436: GTP-binding protein Era" amino acids 12 to 282 (271 residues), 244.6 bits, see alignment E=1.2e-76 PF01926: MMR_HSR1" amino acids 14 to 128 (115 residues), 89 bits, see alignment E=1.1e-28 PF02421: FeoB_N" amino acids 14 to 169 (156 residues), 53.2 bits, see alignment E=1.1e-17 PF10662: PduV-EutP" amino acids 15 to 171 (157 residues), 36.3 bits, see alignment E=2.1e-12 PF04548: AIG1" amino acids 15 to 121 (107 residues), 28.4 bits, see alignment E=4.6e-10 PF00009: GTP_EFTU" amino acids 56 to 174 (119 residues), 38.4 bits, see alignment E=4.7e-13 PF02492: cobW" amino acids 58 to 137 (80 residues), 21.4 bits, see alignment E=7.8e-08 PF07650: KH_2" amino acids 211 to 287 (77 residues), 70.8 bits, see alignment E=3.2e-23

Best Hits

Swiss-Prot: 59% identical to ERA_BRASB: GTPase Era (era) from Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 100% identity to mag:amb2259)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W512 at UniProt or InterPro

Protein Sequence (303 amino acids)

>AMB_RS11430 GTPase Era (Magnetospirillum magneticum AMB-1)
MNEVPETEQRCGFVAVVGAPNAGKSTLVNALVGTKVSIVSPKVQTTRFRVMGIAMVGEAQ
VVLVDTPGIFAPKKRLERAMVAAAWGGTNDADHICLLIDAAKGYDDESRAIVDKLKETKR
QAILVLNKVDLVKRDKLLGLTAQLDAEGIFTDVFMISALKGDGIADLLAHLGKLVAPGPW
MFPEDQVSDLPQRLLAAEITREKAFLALYQELPYSLHVETEKWEEKDDGSARIDQVIYVE
RESQKPIVLGKAGRQIKSIGAAARQELEELLERRVHLFIHIKVREDWSEKRGHYSEIGLD
FDS