Protein Info for AMB_RS11425 in Magnetospirillum magneticum AMB-1

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02191: ribonuclease III" amino acids 10 to 225 (216 residues), 231.8 bits, see alignment E=3.5e-73 PF14622: Ribonucleas_3_3" amino acids 19 to 145 (127 residues), 121 bits, see alignment E=5.8e-39 PF00636: Ribonuclease_3" amino acids 44 to 134 (91 residues), 75.5 bits, see alignment E=7.8e-25 PF00035: dsrm" amino acids 160 to 225 (66 residues), 52.2 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 47% identical to RNC_BRADU: Ribonuclease 3 (rnc) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to mag:amb2258)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W513 at UniProt or InterPro

Protein Sequence (228 amino acids)

>AMB_RS11425 ribonuclease III (Magnetospirillum magneticum AMB-1)
MKGAAAELSALLGHAFARPELLAQALTHPSMHQGRKSRTSDPYERLEFLGDRVLGLVVAE
MLFSRFPNEAEGALARRHAALVRREAVARIATEIGLGRCLVLAKGEDDAGGRANPGILAD
ACEAVIGALYADAGFAVAASFVRSRWEPMMEEALAPPKDAKTGLQEWAQGRGKPLPHYQV
LGQEGPPHEPIFLIEVSVEGVGSAVGRGASKRVAEQAAAGLLLEQVKT