Protein Info for AMB_RS11405 in Magnetospirillum magneticum AMB-1

Annotation: pyridoxine 5'-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00559: pyridoxine 5'-phosphate synthase" amino acids 5 to 238 (234 residues), 280 bits, see alignment E=8.3e-88 PF03740: PdxJ" amino acids 5 to 237 (233 residues), 336.4 bits, see alignment E=3.5e-105

Best Hits

Swiss-Prot: 76% identical to PDXJ_RHORT: Pyridoxine 5'-phosphate synthase (pdxJ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03474, pyridoxine 5-phosphate synthase [EC: 2.6.99.2] (inferred from 100% identity to mag:amb2254)

MetaCyc: 56% identical to pyridoxine 5'-phosphate synthase (Escherichia coli K-12 substr. MG1655)
Pyridoxine 5'-phosphate synthase. [EC: 2.6.99.2]

Predicted SEED Role

"Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.6.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W517 at UniProt or InterPro

Protein Sequence (243 amino acids)

>AMB_RS11405 pyridoxine 5'-phosphate synthase (Magnetospirillum magneticum AMB-1)
MTRLRLGVNIDHVATIRNARGGHHPDPVRAAHMAAAAGADGITAHLREDRRHISDRDMER
LANEISLPLNFEMAATEEMVSIALRHRPHAACIVPEKREERTTEGGLDVVGQFESLKPLV
GRLSEAGIRVSMFIEADPRQLDASKALGAPVIELHTGAYCDAEGEARDREFARIKAAAAH
AQAIGLECHAGHGLSYDTVKPVAAITSIMELNIGHFLVGEAIFVGLDASIRHMRRLMDEA
RGA