Protein Info for AMB_RS11395 in Magnetospirillum magneticum AMB-1

Annotation: DNA-directed RNA polymerase subunit omega

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 TIGR00690: DNA-directed RNA polymerase, omega subunit" amino acids 1 to 58 (58 residues), 57.6 bits, see alignment E=5.1e-20 PF01192: RNA_pol_Rpb6" amino acids 8 to 59 (52 residues), 66.8 bits, see alignment E=6.9e-23

Best Hits

Swiss-Prot: 100% identical to RPOZ_MAGSA: DNA-directed RNA polymerase subunit omega (rpoZ) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03060, DNA-directed RNA polymerase subunit omega [EC: 2.7.7.6] (inferred from 100% identity to mag:amb2252)

Predicted SEED Role

"DNA-directed RNA polymerase omega subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W519 at UniProt or InterPro

Protein Sequence (126 amino acids)

>AMB_RS11395 DNA-directed RNA polymerase subunit omega (Magnetospirillum magneticum AMB-1)
MARVTVEDCVLKVPNRFELVLIAGQRARDISAGAKLTVERDNDKNPVVALREIADDTVPL
DALQNALIQNLQKHVEVDEPEEDEMEGFIADRDLAFENVANEDEMIEDGMSINDTGADFD
VDSGDE