Protein Info for AMB_RS11375 in Magnetospirillum magneticum AMB-1

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 226 to 347 (122 residues), 65.2 bits, see alignment E=6.2e-22 amino acids 354 to 469 (116 residues), 62.4 bits, see alignment E=4.6e-21 PF00989: PAS" amino acids 234 to 326 (93 residues), 31.3 bits, see alignment E=5.2e-11 amino acids 354 to 460 (107 residues), 47.4 bits, see alignment E=5.5e-16 PF13188: PAS_8" amino acids 234 to 271 (38 residues), 15.8 bits, see alignment 3.2e-06 amino acids 353 to 393 (41 residues), 25.7 bits, see alignment 2.4e-09 PF08448: PAS_4" amino acids 237 to 342 (106 residues), 28 bits, see alignment E=6.8e-10 amino acids 356 to 465 (110 residues), 26.7 bits, see alignment E=1.7e-09 PF13426: PAS_9" amino acids 248 to 340 (93 residues), 56.9 bits, see alignment E=6.9e-19 amino acids 360 to 462 (103 residues), 58.8 bits, see alignment E=1.7e-19 PF08447: PAS_3" amino acids 254 to 334 (81 residues), 27.2 bits, see alignment E=1.2e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 472 to 632 (161 residues), 133.8 bits, see alignment E=5e-43 PF00990: GGDEF" amino acids 474 to 630 (157 residues), 163.3 bits, see alignment E=1.3e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2248)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W523 at UniProt or InterPro

Protein Sequence (642 amino acids)

>AMB_RS11375 GGDEF domain-containing protein (Magnetospirillum magneticum AMB-1)
MPDHGERITRDLTIRYITVLAVLGVVALLSFFALARIVTDAGESSELVQLTGEQRVLVQQ
AVFETHRFLVASGEDRVAARRSLASVLDGLEAGHQRLFFADARFLSPPAREVLTASPWNL
DREMRDFVRFGRAILSLPDSAEGHKTNLAGITLKAAKPLMSGLDEVSSRFRRDAAGQLNE
VVTVQGTSLFVALGLLLLSAVGVFRPMVKRLKADITERSEAAARLAESEARLWRMLEESP
VGVSVSRRRDGKVVFANSRFTDIIGMSREEFLGSKAREHYVDDAQRQVVLAMLRRDGRLD
DAEVEFRRKNGSPFWSLLTIHPLDFENEPVNLAWIYDITERKAAEQQILLAAKVLETVTE
AVVITDADNRIIFVNPAFTTITEYTKEEVRGKNPSFLSSGRHDPEFYAGLWQVLSVSGHW
AGEIWNRRKSGAFYAEWLSINALRDVSGAITHFVAVFSDITHRKEDEERIWRQANYDALT
GLPNRSLFVDRLNQAVRQSKRDKKRFALMFLDLDGFKAVNDTLGHAAGDVLLQQTAARLH
QCMRATDTLARLAGDEFVVILEGVHDRDNPALVAGKILATLSKPYDLEVGTAHVRGSIGI
ALYPEDAADGPALIRRADTAMYAVKRRGKNSFLFAGDFPPEA