Protein Info for AMB_RS11325 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF08238: Sel1" amino acids 59 to 94 (36 residues), 29.3 bits, see alignment 1.8e-10 amino acids 96 to 129 (34 residues), 32.7 bits, see alignment (E = 1.6e-11) amino acids 131 to 164 (34 residues), 27.1 bits, see alignment (E = 9.4e-10) amino acids 170 to 201 (32 residues), 15 bits, see alignment (E = 6.1e-06) amino acids 203 to 239 (37 residues), 33.9 bits, see alignment 6.8e-12 amino acids 240 to 273 (34 residues), 27.4 bits, see alignment (E = 7.4e-10) PF00089: Trypsin" amino acids 349 to 489 (141 residues), 42.6 bits, see alignment E=1.3e-14 PF13365: Trypsin_2" amino acids 351 to 485 (135 residues), 95.2 bits, see alignment E=1.3e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2240)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W531 at UniProt or InterPro

Protein Sequence (556 amino acids)

>AMB_RS11325 hypothetical protein (Magnetospirillum magneticum AMB-1)
MTQRPRMARPLAPFALAAFLALGAVPALAGYDEGLTAYQKRDWTSAIREFRPLATQGNAA
AQARLGHMLFEGLGGTRDDVEALKLLNAAAASGDSLAQYWLGSAYFNGRAVPKDISQALV
WFGRSADKGQPEALHAMGEIHFNGLGINKDEGRGIEYFKRGAEKDWPPSLDRLAQYSWDG
RAMPTDKVKALEYARPAAEAGRPVAQFIVGVAYLLGQGGVEKDAAKAAPWFRKAADQGHP
QSQHNLGVMYLNGSGVPKSQAEGYFWMALGAERAPANLKANYEKERDAAGTRLSPAELEA
LRGRVALWRPNAAPGQPSAQVVSPASRAPMPPGQQSATTPPPATSGKISSGSGFVVSADG
VVMTNAHVVEQCRSITIKPQDAPAQVVSLKAKDSANDMALLKTSLRLPEVARFRQDRPLR
SGDEVVVIGFPLSSLLSREPNVTAGVVSALNGMRGDPRHYQITAPVQKGNSGGPLIDMSG
NIVGIVTSKLNAMKIADKTGDLPQNINFAIKADLARSYLDSNGVSYQTAESSAQLSVADV
GERIKRVTVFIECRME